PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_04599_BGI-A2_v1.0
Common NameF383_17201
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Nin-like
Protein Properties Length: 982aa    MW: 109224 Da    PI: 7.0581
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_04599_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.13.5e-28603654152
                      RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                 aek+i+l++l++yFs ++kdAAk+Lgvc+T+LKr+CRq+GIkRWP+Rk++++
  Cotton_A_04599_BGI-A2_v1.0 603 AEKTITLQVLRQYFSESLKDAAKSLGVCPTTLKRTCRQHGIKRWPSRKLHKV 654
                                 589**********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.7593674IPR003035RWP-RK domain
PfamPF020421.6E-24606654IPR003035RWP-RK domain
SuperFamilySSF542771.8E-19829899No hitNo description
PROSITE profilePS5174523.091831907IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.1E-18831899No hitNo description
SMARTSM006664.9E-20831919IPR000270PB1 domain
PfamPF005648.9E-15832899IPR000270PB1 domain
CDDcd064073.84E-36833911No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 982 aa     Download sequence    Send to blast
MEDSILSPVM QLDYMDELLL DGCWLEASPT EGSDFLDPNA FFDPTFEWPI LDSNGGDLGG  60
SLFQGENQIS FLPGNPHMNE NHSQGAHLSP NLDDVDGMSR NLHGDCMTNT SELSRRWWIG  120
PRTNPGPSTS VMLRLIGALN HIKDSAKETD VLVQLWLPVN KGGRRILTTS EQPFSLDPNS  180
QRLASYRNIS VKYQFPAEED SKDMAGLPGR VFLSKVPEWT PDVRFFRSDE YHRVDHAQQH  240
GVRGTFALPV FEQGNRTCLG VIEVVMTTEK IKIKPEMESV CKALEAVNLR SFTASSTGNI  300
QACNSSYQAA LPEIKEVLKR ACETHRLPLA QTWVPCMQLG KEGCPHSTEN YFHCVSTVDD  360
ACYIAEPNIR GFHEVCSEHH LLKGQGVAGR AFMTNQPCFS TDITSFKKTE YPLAHHAKMF  420
KLHAAVAIRF RCIHTGKADF VLEFFLPADC RDPEGKKEML NSLSIILQQV CCSLRVVTNE  480
ELEEDRDMAV SEVIASLDGI PSRKELSEDQ CTYHSEKYSR ESSSWTVSLT EVNQSSSTST  540
STAMKLRKGK PRATWDEKLS KVKQHKKQIS LRGSVEGGDS TINEISFSSA TKRKTGQKRR  600
SKAEKTITLQ VLRQYFSESL KDAAKSLGVC PTTLKRTCRQ HGIKRWPSRK LHKVGNSLEK  660
LQHVIDSVQG VSGAFHISSL YPKFPELASP RPSGKSTSSA SVLGLNDKPK QKPILPEGGN  720
FVSQAATSNS PSSSCSQSSS SSHSCSSGTH QPSKFNISGN GGVIIGENSG NGELKRVTND  780
TELHTLSQEG LKLFPRSQSP ASVKEQLISD SIQPVITENN SQIAQDLDAQ TQKVKVTYGD  840
EKIRFRMQSK WRLKDLLLEI TRRFNIDDIS GFDLKYLDDD SEWVLLTCDA DLEECIDVAL  900
VLLDLKYLVN DLDLVLIEKN NVFEIKNLIA GCSAEGNARF RLSSRGTCRR STIKEILVTG  960
FGLMTMFCMA EAGFKFKSFI QP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012446359.10.0PREDICTED: protein NLP4-like isoform X1
RefseqXP_012446360.10.0PREDICTED: protein NLP4-like isoform X1
RefseqXP_012446362.10.0PREDICTED: protein NLP4-like isoform X1
TrEMBLA0A0B0NIE20.0A0A0B0NIE2_G
STRINGPOPTR_0005s27310.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein